SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S1CHH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S1CHH5
Domain Number 1 Region: 26-187
Classification Level Classification E-value
Superfamily MtlR-like 4.58e-59
Family MtlR-like 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S1CHH5
Sequence length 195
Comment (tr|S1CHH5|S1CHH5_9ESCH) Mannitol operon repressor {ECO:0000313|EMBL:EOV46045.1} KW=Complete proteome OX=1182659 OS=Escherichia sp. KTE52. GN=A1SC_03248 OC=Enterobacteriaceae; Escherichia.
Sequence
MVDQAQGSLRPNNRLSDMQATMEQTQAFENRVLERLNAGKTVRSFLITAVDLLTEAVNLL
VLQVFRKDDYAVKYAVEPLLDGNGPLGDLSVRLKLIYGLGVISRHEYEDAELLMALREEL
NHDGNEYAFTDDEILGPFGELHCVAALPPPPQFEPADSSLYAMQVQRYQQAVRSTMVLSL
TELISKISLKKAFQK
Download sequence
Identical sequences A0A1X3M4I6 A0A2B7LPC9 A0A2I8C831 L2VM93 S1CHH5 S1G9Z2 S1L4B8
WP_000228285.1.101935 WP_000228285.1.11948 WP_000228285.1.13979 WP_000228285.1.35985 WP_000228285.1.36786 WP_000228285.1.49376 WP_000228285.1.52804 WP_000228285.1.81739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]