SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S2JFB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S2JFB9
Domain Number 1 Region: 246-290
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000518
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  S2JFB9
Domain Number - Region: 97-188
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0497
Family Capz beta-1 subunit 0.046
Further Details:      
 
Domain Number - Region: 308-361
Classification Level Classification E-value
Superfamily RING/U-box 0.0628
Family RING finger domain, C3HC4 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S2JFB9
Sequence length 469
Comment (tr|S2JFB9|S2JFB9_MUCC1) Uncharacterized protein {ECO:0000313|EMBL:EPB88579.1} KW=Complete proteome; Reference proteome OX=1220926 OS=agent) (Calyptromyces circinelloides). GN=HMPREF1544_04572 OC=Mucoraceae; Mucor.
Sequence
MARFWTRLFYSKKKKLPVIVFDDYAQSKHLKESYMYGKHLVRVDKLQNAYCHLQQQQQRS
QAPFWRFMDPFIQTWYSELERVCRASQSALIMLNTQLEEVSNTICFISSPLKNQNRKSLK
KAHQFITTCLDEWDCSINSNGLYQDHFEKLESLVQHEFGTYSSPNLRQCIKQVYRFKQNL
QLYHYYIISQFDMLWDLGSTAMQLEPSTDVPLLQVMKSRWQQKYTHELKSYASITGAFHT
LLKKSTPVRQDFTCAVCLSIWHEPTTLQCNHTFCRNCVQHMVCASCHKFRRKTVNRISEG
LVHWIKPSPAVYCACQTFNHLGQITPLNKEGTCPLCRTLFSPLDCVVDEELSRFVHLYFP
KSSLKDEQEEEDTAQDNECNQYVTKKRKSTIQTDNVDTQRRRRRRSQASAAKLYSKMQRW
SNKWSVDHDSANAGIMDQAVPPVPGRPFASTQRQVNYEMLVMARRSWMF
Download sequence
Identical sequences S2JFB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]