SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S2R6V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S2R6V0
Domain Number - Region: 19-80
Classification Level Classification E-value
Superfamily alpha-Amylase inhibitor tendamistat 0.00536
Family alpha-Amylase inhibitor tendamistat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S2R6V0
Sequence length 96
Comment (tr|S2R6V0|S2R6V0_LACPA) tRNA-specific 2-thiouridylase MnmA {ECO:0000313|EMBL:EPC73992.1} KW=Complete proteome OX=1256208 OS=Lactobacillus paracasei subsp. paracasei Lpp41. GN=Lpp41_05418 OC=Lactobacillus.
Sequence
DNPALMATSLSASNLNWTTGQAPAEGTHMTAKFRYRQRDTGVTLHYHDDGTATVDFDVPV
RAITPGQAVVFYDGDECLGGGTIDAAYAHTNELQYV
Download sequence
Identical sequences S2R6V0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]