SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S2VID7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S2VID7
Domain Number - Region: 55-86
Classification Level Classification E-value
Superfamily Protein HNS-dependent expression A; HdeA 0.0432
Family Protein HNS-dependent expression A; HdeA 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S2VID7
Sequence length 133
Comment (tr|S2VID7|S2VID7_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EPD27218.1} KW=Complete proteome OX=641143 OS=Capnocytophaga granulosa ATCC 51502. GN=HMPREF9331_02413 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
METLGTPIRKREVYDYMSETTNEIHLLLKDILQHDKAITYEDGEKVYVLISQALTKEKKV
ILDFQGITIVIPAFLHASVGELYKDFDGDFLNNHLILKNIEGTNKVLLDMVIKYTKQYIA
DPEAFERAIKSTF
Download sequence
Identical sequences S2VID7
WP_016421226.1.65570 WP_016421226.1.82496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]