SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S3BTU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S3BTU8
Domain Number 1 Region: 5-257
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.98e-74
Family Capz alpha-1 subunit 0.00000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S3BTU8
Sequence length 266
Comment (tr|S3BTU8|S3BTU8_OPHP1) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EPE03897.1} KW=Complete proteome; Reference proteome OX=1262450 OS=Ophiostoma piceae (strain UAMH 11346) (Sap stain fungus). GN=F503_01787 OC=Ophiostoma.
Sequence
MPSDASIISAFVADAPPGELSNVVADIESLTGKSANLDDAYEKYNEDQFVTVQLPGGGAK
EIAIVSEWSRLGGGRYYDPSSATSFAFDHKTQKASSAQSHAVEGELVQSILKALGIYAKE
HYERPAYGVYALDDERVGVLIASNKYSPQNFWNGRWRARYIYDPASGTVEGSIRVDVHYY
EDGNVRLLTDKPQTASAAANGVAVVREIAALEKTYQEELNKKFLALSEGAFKGLRRQLPV
TRQKIEWEKVASYRLGQDIGGGGGRK
Download sequence
Identical sequences S3BTU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]