SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S4CKG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S4CKG6
Domain Number - Region: 53-132
Classification Level Classification E-value
Superfamily Bet v1-like 0.00192
Family Smu440-like 0.055
Further Details:      
 
Domain Number - Region: 6-75
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0759
Family Capz alpha-1 subunit 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S4CKG6
Sequence length 137
Comment (tr|S4CKG6|S4CKG6_ENTFL) Uncharacterized protein {ECO:0000313|EMBL:EPH89833.1} KW=Complete proteome OX=1260358 OS=Enterococcus faecalis 06-MB-DW-09. GN=D922_03207 OC=Enterococcus.
Sequence
MEITKKMNVPADFLYKTIIDSVLHDIKQATDQTLTEEQLEGYSYLKQFYKDSNATITIET
VKKNQAYVFQTATKKNTFRVHYQIEAIDESHCNLHYEEKMTSEGMIQQLNDMLLGTILGY
FKRKQFKKMLSMMEEAY
Download sequence
Identical sequences S4CKG6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]