SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S4EVG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4EVG5
Domain Number 1 Region: 218-326
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-18
Family CHAP domain 0.014
Further Details:      
 
Weak hits

Sequence:  S4EVG5
Domain Number - Region: 145-234
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S4EVG5
Sequence length 345
Comment (tr|S4EVG5|S4EVG5_ENTFC) CHAP domain protein {ECO:0000313|EMBL:EPI23566.1} KW=Complete proteome OX=1244152 OS=Enterococcus faecium SB2C-2. GN=D354_01035 OC=Enterococcus.
Sequence
MKPVTPTAPAEKPVEQPAASTPQPEIVPPVTNETVGLVEDDETFTVSKTKKTEEFIQEIG
ESARKVAKDKNLYASVMIAQAILESGSGNSKLSQKPNYNLFGIKGDYKGQSVSFITYEDN
GFGNLYTVEAKFRQYPTYKESMEDYAKLLKNGLDSNKNFYHGVWKTEAKSYKEATRFLTG
KYATDKDYHKKLNALIKTYDLTYYDKEKATVEPMESNFPAYNGKNYDTFNSYAWGNCTQY
VYNRITQLGKRVDLTMGNGQDWGETGRARGYKVSRTPKAGAAVSFPAGVLGADNTYGHVA
FVEKVFKDGSILISEMNVKGLNVVSTRTISADETHLMNYIVPKDK
Download sequence
Identical sequences S4EVG5 S4GXM9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]