SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S4PW49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4PW49
Domain Number 1 Region: 3-149
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.75e-59
Family Capz beta-1 subunit 0.000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S4PW49
Sequence length 149
Comment (tr|S4PW49|S4PW49_9NEOP) Capping protein beta {ECO:0000313|EMBL:JAA85152.1} OX=116150 OS=Pararge aegeria (specked wood butterfly). GN= OC=Papilionoidea; Nymphalidae; Satyrinae; Satyrini; Parargina; Pararge.
Sequence
MTEQQMDCALDLMRRLPPQQIEKNLTDLIDLVPSLCEDLLSSVDQPLKIAQDRSNGKDYL
LCDYNRDGDSYRSPWSNTYDPPLEDGSMPSERLRKLEIEANHAFDQYREMYFEGGVSSVY
LWDMDHGFAGVILIKKAGDGSQKIKGCWD
Download sequence
Identical sequences S4PW49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]