SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S6A2N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S6A2N4
Domain Number - Region: 7-48
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.026
Further Details:      
 
Domain Number - Region: 38-112
Classification Level Classification E-value
Superfamily OMPA-like 0.0549
Family GNA1870 immunodominant domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S6A2N4
Sequence length 127
Comment (tr|S6A2N4|S6A2N4_9SPIO) Uncharacterized protein {ECO:0000313|EMBL:AGT42831.1} KW=Complete proteome; Reference proteome OX=1291379 OS=Treponema pedis str. T A4. GN=TPE_0335 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MVLTAGAALIAGCKHNKMKMYEGRYEGKWSFKNTNQKGTWSGTVDSSGNFKGALSDDAEP
GKSISFTLTVSTSGAVSGTIERTDNGQKYLTKVDGSINNNNVTGTLSLTMEGSANVIDTG
TITGKKQ
Download sequence
Identical sequences S6A2N4
gi|530892252|ref|YP_008433967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]