SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S7PPY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S7PPY4
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.16e-54
Family Capz beta-1 subunit 0.000000076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S7PPY4
Sequence length 184
Comment (tr|S7PPY4|S7PPY4_MYOBR) F-actin-capping protein subunit beta {ECO:0000313|EMBL:EPQ10472.1} KW=Complete proteome; Reference proteome OX=109478 OS=Myotis brandtii (Brandt's bat). GN=D623_10012531 OC=Vespertilionidae; Myotis.
Sequence
MPSARLRKLEVEANNAFDQYRDLYFEGSVSSVYLWDLDHGFAGVILIKKAGEGSKKIRGC
WDSIHVVEVQKSSGRTAHYKLTSTVMLWLQTNKSSSGTKNLGGSLTRQVEKDETVSDSSP
HIANIGRLVEDMENKIRSAQNEIYFGKTKDIVNGLRSVQTFADKSKQEVLKNDLVEALKR
KQQC
Download sequence
Identical sequences S7PPY4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]