SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S7WHW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S7WHW7
Domain Number 1 Region: 13-292
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.93e-60
Family Capz beta-1 subunit 0.00000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S7WHW7
Sequence length 329
Comment (tr|S7WHW7|S7WHW7_TOXGG) Putative F-actin-capping protein subunit beta {ECO:0000313|EMBL:EPR63948.1} KW=Complete proteome OX=507601 OS=Toxoplasma gondii (strain ATCC 50853 / GT1). GN=TGGT1_219290 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MFATGNSPVPAAMEESWIAAVSLTRRMPPKLIDRTVAGVQHLCPDLSIQLLTRVDRRLRL
CFDSEARKFFIACIYNQHGSSFRSPWTNAYIEGNDVSVLGAVPQRRIKPADNLRNLETTY
NRIFDSYRRAYYEGGVSSVYLWSLPSEDGFAGAFLVRHALDGGVSGDGPRGCWESVHVVE
VTQSTSNVHYRLTSTVMVDVDPPENAEANFYAGAMLTRTSEQSQKVTDLLTGPEVPPHIG
VIGPMIEAMEDRMRTAIERNYFAKAYSILDGMIRTRHNTKEQKKAAFFSELSSSLSLLSR
GSGGGPGSPGGRSMRGSRSFLRPRSGSDN
Download sequence
Identical sequences S7WHW7
gb|TGGT1_030260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]