SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S8BRD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S8BRD1
Domain Number 1 Region: 5-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-78
Family Capz alpha-1 subunit 0.00000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S8BRD1
Sequence length 269
Comment (tr|S8BRD1|S8BRD1_DACHA) Uncharacterized protein {ECO:0000313|EMBL:EPS42018.1} KW=Complete proteome; Reference proteome OX=1284197 OS=(Monacrosporium haptotylum). GN=H072_4075 OC=Orbiliales; Orbiliaceae; Dactylellina.
Sequence
MSAISTASSFIENAPPGELSEVIKDIESLLEHSPRGGFADAVAAYNKQQYVTTKLPGSSG
LVIVSSYNEIEEGRFFDSESSTSFAFNHTTQKASDVQSYSIEGEHASTVKSLVQAVGNHV
KEHFPSLPAHGVYPTDDGIAILIVGNKYSPSNYWNGRWRSTYIYNPSASTLTGTIAVDVH
YYEDGNVRLVTEKAVSENLRSSTSAGIVTTIASVEKKYQEELNRAFGALSEGAFKSLRRQ
LPVTRQKMDWDKAAAYKLGQDIGGAGKSR
Download sequence
Identical sequences S8BRD1
XP_011110035.1.41699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]