SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S8CC84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S8CC84
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-33
Family Capz beta-1 subunit 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S8CC84
Sequence length 150
Comment (tr|S8CC84|S8CC84_9LAMI) Uncharacterized protein {ECO:0000313|EMBL:EPS64564.1} KW=Complete proteome; Reference proteome OX=192259 OS=Genlisea aurea. GN=M569_10217 OC=Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea.
Sequence
YYEGGISSVYMWEDENEGFIACFLIKKDGSKSAHGKRGYLQEGSWDAIHVIQVAPEEETA
RYCLTSSVMLSLTTSDESSGSFNLSGSLRRQMSMELSISEGHLCNMGRMIEEMESKLRNS
LDQVYFGKTKEMVCTLRPPSEIIDMSLPKS
Download sequence
Identical sequences S8CC84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]