SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S8DS64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S8DS64
Domain Number 1 Region: 5-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-80
Family Capz beta-1 subunit 0.0000000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S8DS64
Sequence length 286
Comment (tr|S8DS64|S8DS64_FOMPI) Uncharacterized protein {ECO:0000313|EMBL:EPS96091.1} KW=Complete proteome; Reference proteome OX=743788 OS=Fomitopsis pinicola (strain FP-58527) (Brown rot fungus). GN=FOMPIDRAFT_1025510 OC=Agaricomycetes; Polyporales; Fomitopsis.
Sequence
MGDLVDSMLDLMRRLPPTHVEENVAALVAMCPDYADDLLGSVDQPLKVLTDRATGRDYLA
CDYNRDGESYRSPWSNEYDPPLEDGTVPTPRLRKLEITANEAFDTYREMYYEGGVSSVFL
WDLDDGGFAGVVLLKKVLNASLPNEPSGSWDSIHVFEAAERGRQAHYKLTSTIMLQMTNR
SIAAAGKDERSKESSAGDASREGEVLLSGSMTRQSEQDHALHDQASHISNTGKMIEEMEI
KMRNLLQEVYFGKTRDIVFDLRSIDDLEKARRQRELQKELVGFIKR
Download sequence
Identical sequences S8DS64
jgi|Fompi1|162610|estExt_fgenesh1_kg.C_820003 jgi|Fompi3|1025510|fgenesh1_kg.73_#_3_#_isotig06318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]