SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S9BFJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S9BFJ9
Domain Number - Region: 12-87
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0628
Family Capz alpha-1 subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S9BFJ9
Sequence length 149
Comment (tr|S9BFJ9|S9BFJ9_STRAG) Uncharacterized protein {ECO:0000313|EMBL:EPV91178.1} KW=Complete proteome OX=1154776 OS=Streptococcus agalactiae FSL S3-586. GN=SAG0014_12155 OC=Streptococcus.
Sequence
MSFKTDYNTQSSVYFYSIHPYLYLTHESKDAIEKKKHVYDKADITLLSNFDIDRYLTLDV
EEKDDMLNEVCDLIDEYDIANMRELRRFIKLHGAEHGLPSIKIINSVLRSHTGLIRLYFD
AVYQERKYGSNISNVNQETGEILSEGSDD
Download sequence
Identical sequences S9BFJ9
WP_025195110.1.80438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]