SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S9PSU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9PSU2
Domain Number 1 Region: 4-254
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-76
Family Capz beta-1 subunit 0.000000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S9PSU2
Sequence length 265
Comment (tr|S9PSU2|S9PSU2_SCHOY) F-actin capping protein beta subunit {ECO:0000313|EMBL:EPX70553.1} KW=Complete proteome OX=483514 OS=(Octosporomyces octosporus). GN=SOCG_04653 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MLPEDAALDLLRRLNPKDISKNLDAILAVAPDLADVLLSSVDQPLQVSNCSESGNQYLLC
DFNRDGDSYRSPWTNKYDPPLEDGLVSSDRVRKLESALNEAMRVYLDLYYEGGVSSVYLW
DQDDSYAGAVLIKKASSSGSCGWDSIHVFECLPTSETDVFDYRLTSTIILYLGSDQQSSL
VSGALSLSGHLTRQTSQRMPASDQDGEVSNIGRLVEEMETRMRNFLQEVYFDKTRDIINQ
TRSIQPISENPDKMALRSVLKNLSN
Download sequence
Identical sequences S9PSU2
XP_013020699.1.790 SOCG_04653T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]