SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S9X0E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9X0E7
Domain Number 1 Region: 5-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-58
Family Capz alpha-1 subunit 0.0000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S9X0E7
Sequence length 256
Comment (tr|S9X0E7|S9X0E7_SCHCR) F-actin capping protein alpha subunit {ECO:0000313|EMBL:EPY50422.1} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_01179 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MDGESIYRFIRESPPGEVNQVVQDLRELGLTDEERIQKELQLHHEDSNSPVTLSKDERVV
LSAQSKLDNGRYYDQRLQKSFAVNYETMEAIDVEDYKEKPTISEDIVKQIQKVTLDHYLS
DVSIAIIQNDVNVQEYSIILVSLKYNPQNYYNGRWRCVCKYDTEIKKLVGTSFIRVHYYE
DGNVWLDAERPIDVSVNDVGKLSDALTEVENANQRSFNVELSSLNDKKFKELRRQLPITR
QKINWENVLGIRMRNA
Download sequence
Identical sequences S9X0E7
EPY50422 XP_013024905.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]