SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S9XCZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9XCZ5
Domain Number 1 Region: 5-258
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-75
Family Capz beta-1 subunit 0.000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S9XCZ5
Sequence length 266
Comment (tr|S9XCZ5|S9XCZ5_SCHCR) F-actin capping protein beta subunit {ECO:0000313|EMBL:EPY51711.1} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_00136 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MLSEDAALDLLRRLNPKDISKNLDAILAVAPDLADVLLSSVDQPLQIGTCSESGNQYLLC
DFNRDGDSYRSPWTNKYDPPLEDGLVSSDRVRKLELALNEAMRVYLDLYYEGGVSSVYLW
DQDDSYAGAVLIKKASSSGTCGWDSIHVFECLPTSETDVFDYRLTSTIILYLGSSDRSSS
LVSGALNLSGHLTRQTSQRMPASEQDSEVGNIGRLVEEMETRMRNFLQEVYFDKTRDIIN
QTRSIQPISENPDKTALRSVLNNLSN
Download sequence
Identical sequences S9XCZ5
XP_013023097.1.62511 EPY51711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]