SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9Y4X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S9Y4X4
Domain Number - Region: 97-122
Classification Level Classification E-value
Superfamily Hypothetical protein YojF 0.0575
Family Hypothetical protein YojF 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S9Y4X4
Sequence length 146
Comment (tr|S9Y4X4|S9Y4X4_CAMFR) Uncharacterized protein {ECO:0000313|EMBL:EPY82461.1} KW=Complete proteome; Reference proteome OX=419612 OS=Camelus ferus (Wild bactrian camel) (Camelus bactrianus ferus). GN=CB1_000651008 OC=Camelidae; Camelus.
Sequence
MDFDGVCGQKGITVSVGHFQDLKVDVKGAKGPLQETEDLAAALPRNLIIRSAALTVCGHS
SCSISGLQKPTHRETALSNQGNVWSPGSRDCAVRGAEARLGLQFGNNWIVQKGLTRQELD
LHLRLGKQLSQDWEPKKEKIKEGPAL
Download sequence
Identical sequences S9Y4X4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]