SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9YER9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9YER9
Domain Number 1 Region: 135-206
Classification Level Classification E-value
Superfamily RILP dimerisation region 4.32e-18
Family RILP dimerisation region 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S9YER9
Sequence length 212
Comment (tr|S9YER9|S9YER9_CAMFR) RILP-like protein {ECO:0000313|EMBL:EPY85826.1} KW=Complete proteome; Reference proteome OX=419612 OS=Camelus ferus (Wild bactrian camel) (Camelus bactrianus ferus). GN=CB1_000348009 OC=Camelidae; Camelus.
Sequence
MVSSAQPRPPPRCHRLLFSALRQDSENTLRDRICLHLTAEDVYDISYVMGRELMALGSDP
RVTQLQFKIVRVLEMLETLVNEGNLTVEELRMERDSLRKEVEGLRREGPAAGREVNLGPD
KMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLFVAQEELQCYKSGLIPPREGPRGRREK
DAVVARARNASKNKEEKTIIRKLFFFRSGKQT
Download sequence
Identical sequences S9YER9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]