SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T0ILY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T0ILY3
Domain Number - Region: 50-99
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0889
Family Capz beta-1 subunit 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T0ILY3
Sequence length 126
Comment (tr|T0ILY3|T0ILY3_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:EQB10659.1} KW=Complete proteome OX=1331060 OS=Sphingobium lactosutens DS20. GN=RLDS_27135 OC=Sphingomonadaceae; Sphingobium.
Sequence
MTRSTFLAAALLGLAPAALPTAGLAQTAEGPVSYEEQLAQVEDQLVYQAPIAGVENDYWF
NYQTDLAEARKELTKDLRRSSDAEDNRDAWDEYRAELADARGDYAKEMAEKGYPIGQVRV
LAKNGR
Download sequence
Identical sequences T0ILY3
WP_021228852.1.508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]