SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T0NLF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T0NLF3
Domain Number - Region: 29-92
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz alpha-1 subunit 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T0NLF3
Sequence length 216
Comment (tr|T0NLF3|T0NLF3_9EURY) Uncharacterized protein {ECO:0000313|EMBL:EQB74190.1} KW=Complete proteome; Reference proteome OX=261388 OS=Ferroplasma sp. Type II. GN=AMDU4_FER2C00027G0030 OC=Ferroplasmaceae; Ferroplasma; environmental samples.
Sequence
MNLKSHYKIIISIIIVIILFLPLIIYYYPYNNTEYNNNGESVDVKYFHNEYSIYACMFNS
NYSASSYSTGNSESYLNTTLTNPAYYQLEGQLMSHINISMKNINARYVYITTTGSNNDQY
VQITGTHTPINCKQEGNKWINKYSSFDNLHSMGINFGIPSFYLHNGNYNFTLTVSAGKLH
NTFYIDTEKESAIYGSKYRIILQVHHMAQSKHNTIY
Download sequence
Identical sequences T0NLF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]