SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T0QAG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T0QAG5
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.24e-74
Family Capz beta-1 subunit 0.000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T0QAG5
Sequence length 276
Comment (tr|T0QAG5|T0QAG5_9STRA) Capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:EQC31666.1} KW=Complete proteome; Reference proteome OX=1156394 OS=Saprolegnia diclina VS20. GN=SDRG_10831 OC=Saprolegnia.
Sequence
MSDDALSCCLNVLRRMPPGQVATDLAGLCQLVPELEDELLQRVDQPLGQMVDPTTGRAFL
LCDYNRDGDSHRSPWTNAYFPPIDDGEGFTPSDSLRQLEIQANEIFDVYREMYYQGGISS
VYMWDLEPGFAACFLIKKDVHQQRFVQNGGWNSIHVIEVQEKSAKEAVYKLTTTILVTMD
VNRNELGHLNLDGNLTRQTEKVLPFDGPSAHLTNMGHLIEDMEIEMRSSLDRVYISKTRE
VINGIRKLQHGPTQGSIFVGELGRAVLKHGVPKPTA
Download sequence
Identical sequences T0QAG5
XP_008615065.1.67053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]