SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T1ERM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1ERM4
Domain Number - Region: 90-151
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz beta-1 subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1ERM4
Sequence length 154
Comment (tr|T1ERM4|T1ERM4_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO02311.1, ECO:0000313|EnsemblMetazoa:HelroP161566} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_161566 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MHDSCKYIATNKSQLQIRKLRSDVKGYTYKRNFFISDYKSVSFWYQDNEIQKCLSRVYGE
FTHVCSVTNYLPDIDYCCCTVDETFERNKNNDNVSILKKKRLKKWATNYGENKTDTAIRL
KRSTEQTSVLCCRYHQDWNKFRCQRSDDYFDPNS
Download sequence
Identical sequences T1ERM4
XP_009019719.1.102002 jgi|Helro1|161566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]