SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T1G6D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G6D3
Domain Number 1 Region: 6-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-93
Family Capz beta-1 subunit 0.00000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1G6D3
Sequence length 276
Comment (tr|T1G6D3|T1G6D3_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN95613.1, ECO:0000313|EnsemblMetazoa:HelroP86506} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_86506 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MSQVDQLLDSALDLMRRLPPQKIDKNLSDLIDLVPNLCEDLLSAVDQPLQIMRDKEVGKD
FLLCDYNRDGDSYRSPWTNQYQPPIDDGAVPSERLRKLEIEANSAFDQYRDMYYEGGVSS
VYLWDLDHGFAGVILIKKAGDGSNKIKGCWDSIHVVEVQEKSSGRAAHYKLTSTAMLWLQ
TSKSGSGTMNLGGSLTRQAESDFNVGEASPHIANIGRMVEEMENKIRNTLNDIYFGKTKD
IVNGLRSTQSAEEQSKKKMLQSELAGALNKRAQTSN
Download sequence
Identical sequences T1G6D3
XP_009026177.1.102002 jgi|Helro1|86506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]