SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T1HIQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1HIQ8
Domain Number 1 Region: 2-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.46e-90
Family Capz beta-1 subunit 0.00000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1HIQ8
Sequence length 275
Comment (tr|T1HIQ8|T1HIQ8_RHOPR) Uncharacterized protein (Fragment) {ECO:0000313|EnsemblMetazoa:RPRC003931-PA} KW=Complete proteome; Reference proteome OX=13249 OS=Rhodnius prolixus (Triatomid bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Rhodnius.
Sequence
TDQQMDCALDLMRRLPPQEIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDNEVGKDYLL
CDYNRDGDSYRISPWSNIYYPTLEDGSMPSERLRKLEIDANTAFDQYREMYFEGGVSSVY
LWDLEINGFAGAILIKKAGDGSKKIKGCWDSIHVVEVQEKSGGRNAKYKLTSTVMLWLQT
NKAGSGTMNLGGSLTRQVELDALVSEASPHIANIGRMVEDMENKIRNTLNEIYFGKTKDI
VNGLRCPESLSAQRTQAVLKQHLVAALHKRQANEN
Download sequence
Identical sequences T1HIQ8
RPRC003931-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]