SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T1ISE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1ISE5
Domain Number 1 Region: 21-287
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-99
Family Capz beta-1 subunit 0.00000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1ISE5
Sequence length 293
Comment (tr|T1ISE5|T1ISE5_STRMM) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SMAR004014-PA} KW=Complete proteome; Reference proteome OX=126957 OS=Strigamia maritima (European centipede) (Geophilus maritimus). GN= OC=Pleurostigmophora; Geophilomorpha; Linotaeniidae; Strigamia.
Sequence
MCRLWIPSTDQGGAGGMTNNEQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSS
VDQPLKIARDKTVGKDYLLCDYNRDGDSYRSPWTNSYDPALEDGAMPSERLRKLEIDANA
AFDQYREMYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSG
RNAHYKLTSTAMLWLQTNKPGSGTMNLGGSLTRQVETDASVSDVSPHIANIGKMVEDMEN
KIRNTLNEIYFGKTKDIVNGLRSVQPIPDQKQQQALCSELTTALKKRQAMGEN
Download sequence
Identical sequences T1ISE5
SMAR004014-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]