SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T4H0U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T4H0U9
Domain Number - Region: 39-108
Classification Level Classification E-value
Superfamily RNA-binding protein She2p 0.0628
Family RNA-binding protein She2p 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T4H0U9
Sequence length 140
Comment (tr|T4H0U9|T4H0U9_CLODI) Uncharacterized protein {ECO:0000313|EMBL:EQI77687.1} KW=Complete proteome OX=1151391 OS=Clostridioides difficile Y384. GN=QQG_3152 OC=Peptostreptococcaceae; Clostridioides.
Sequence
MIISIEVALSGGTLVIGSDGNIRDLAGLRGTYKIIDKTEEALNLIGKFFNKYNAQSLKFY
LDSPVSNSGNLKYGILEYAKTWGIETEVELVKNADVVLEKLDRVVSSDAVIVDKCISYFN
VARGIIEEYIKDCNIVNLNK
Download sequence
Identical sequences T4H0U9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]