SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T5BWZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T5BWZ5
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-85
Family Capz alpha-1 subunit 0.00000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T5BWZ5
Sequence length 274
Comment (tr|T5BWZ5|T5BWZ5_AJEDE) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EQL33590.1} KW=Complete proteome OX=447095 OS=Blastomyces dermatitidis ATCC 26199. GN=BDFG_04342 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Blastomyces.
Sequence
MPSNLEIASSFIRGAPPGELSDVVADIKALTPEGPSLISSLTPAFENYNEEQLATVKLPG
GSENVIVSAYNKLDGNRYYDVESQTSFEFDHVTQTASSPQSYVLESQHSDLIKSLLKSLS
THAREHYPSCSYGVYPTDNDSAAAILLVANKYSPNNFWNGRYRAIYTVPIPSADTITGTI
HINVHYYEDGNVSLNTTKPVSISLSPNSSADTIIKRIAAAERAQQLELSDAFSRLSEGAF
KGLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences T5BWZ5
BDBG_02120T0 XP_002627449.1.14838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]