SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U1FVM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U1FVM2
Domain Number - Region: 57-143
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz alpha-1 subunit 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U1FVM2
Sequence length 160
Comment (tr|U1FVM2|U1FVM2_9STAP) Uncharacterized protein {ECO:0000313|EMBL:ERF48959.1} KW=Complete proteome OX=1357269 OS=Staphylococcus sp. EGD-HP3. GN=N039_01410 OC=Staphylococcus.
Sequence
MRNKFISFLVLILLITFISSPISVLGNEYEDVDSIGTLDESINQAEQDNLPDYVPVKSTQ
HYENRNGIVRFIIKHGMKAYKSIKYAPKYPAGFKPVQNGTKHSTVNNKPLLKDLRKIESG
RWVKVYKNGYVKGKKVSVHYFQSKSGYVFDVKTKNRWSQF
Download sequence
Identical sequences U1FVM2
WP_021459118.1.57946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]