SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U1KZ14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U1KZ14
Domain Number - Region: 17-84
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.017
Family Capz alpha-1 subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U1KZ14
Sequence length 117
Comment (tr|U1KZ14|U1KZ14_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ERG25921.1} KW=Complete proteome OX=1117316 OS=Pseudoalteromonas marina DSM 17587. GN=PMAN_11146 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MPKSKFIIFPILAIISSIIIKLIINLPSDENDKKFVSVSYLVKQNEITNKALEEAFVRQV
ETHNIAGIVEIFNKSQEHNVIMTSVLLKAFDAVDAIANLILILLVIYVVFVYIKREL
Download sequence
Identical sequences U1KZ14
WP_010556386.1.37269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]