SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U1MXZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U1MXZ1
Domain Number - Region: 8-48
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0575
Family Capz beta-1 subunit 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U1MXZ1
Sequence length 90
Comment (tr|U1MXZ1|U1MXZ1_9BACL) Uncharacterized protein {ECO:0000313|EMBL:ERG66721.1} KW=Complete proteome OX=1345023 OS=Exiguobacterium chiriqhucha RW-2. GN=M467_05450 OC=Bacillales Family XII. Incertae Sedis; Exiguobacterium.
Sequence
MRFFKVMTHTNDRGEDIILSEYFKINDKQVDQFLKDTLELDMYDQKVTLKECQIAKDRWE
CPVGDFVVVEYFNEKEFDKMTEYRSPAPKK
Download sequence
Identical sequences U1MXZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]