SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U2G2L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U2G2L1
Domain Number - Region: 7-31
Classification Level Classification E-value
Superfamily alpha-Amylase inhibitor tendamistat 0.00353
Family alpha-Amylase inhibitor tendamistat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U2G2L1
Sequence length 64
Comment (tr|U2G2L1|U2G2L1_9BURK) Uncharacterized protein {ECO:0000313|EMBL:ERJ37497.1} KW=Complete proteome OX=1335308 OS=Burkholderia sp. AU4i. GN=L810_8013 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MCALMTERVGYGDGGDATCKAAQPPRFATVPLAPGFGFPIWPIDVWECHIAREQRGRHAA
GDAL
Download sequence
Identical sequences U2G2L1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]