SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U2JG01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U2JG01
Domain Number - Region: 163-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0497
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U2JG01
Sequence length 411
Comment (tr|U2JG01|U2JG01_9BACT) Uncharacterized protein {ECO:0000313|EMBL:ERJ78725.1} KW=Complete proteome OX=1227276 OS=Prevotella sp. F0091. GN=HMPREF9148_00731 OC=Prevotella.
Sequence
MKKLKYLIMAAVCVLFASCMGESYAEPAETGSAPYGNKELTETNVISIAQLKSNYANYIA
TDYRNGISYAKVTDDIKIKGVVTSSDAAGNIYQEIALQDATGAIIVSVAQGGQHGPLPIG
TEILVSLKDLYVGNYGKQAQIGVPTVNAAGATSIGRISRATWDQHYKILSTGNKVEPTEF
ASGSTPTTWNIDTDGGKLGIIRNVSFKSSNNSKVTDTFADANGGAGSVSWTLNEQDGKKV
IVYNSNFAKFANNKVPTGKVDIVGIFKRFNNQWEIIIRSLDDIKSAEKVDPFKGLPGKGD
GTQANPLDITRALAYAKLNKKDATTYYIKGIISQIDEVSTQYGNARYYLSNDGTSTEQLQ
VFRGLYLNGDKFTDPSQISVGKKVVILGTLDFYEATSTPQVGRNSKIISIN
Download sequence
Identical sequences U2JG01
WP_021672891.1.50889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]