SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U2L2V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U2L2V8
Domain Number - Region: 77-123
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0837
Family Capz alpha-1 subunit 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U2L2V8
Sequence length 152
Comment (tr|U2L2V8|U2L2V8_PORGN) Uncharacterized protein {ECO:0000313|EMBL:ERJ83769.1} KW=Complete proteome OX=1321822 OS=Porphyromonas gingivalis F0566. GN=HMPREF1989_01970 OC=Porphyromonadaceae; Porphyromonas.
Sequence
SIQRNIIQLIKKTKTMKGTEHFKDVIQNYLETRASYDELFAGNFRKENKNIDECITYILT
EVQRMGCAGLSDEEVYSLAVHYYDEDNIKVGTSVNCQVVVNHTIELTEEEKAEARKKAIE
RYQAEEYRKLTAKKPKAEKQAEEQLQPSLFEF
Download sequence
Identical sequences U2L2V8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]