SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U2QMG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U2QMG1
Domain Number - Region: 27-84
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0262
Family Capz alpha-1 subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U2QMG1
Sequence length 132
Comment (tr|U2QMG1|U2QMG1_9BACL) Uncharacterized protein {ECO:0000313|EMBL:ERK57706.1} KW=Complete proteome OX=1321820 OS=Gemella bergeriae ATCC 700627. GN=HMPREF1983_01031 OC=Bacillales Family XI. Incertae Sedis; Gemella.
Sequence
MLLNVWSHVANFSILLAYVSIYLTYRTFKNTKNIQIQINKNTNRLLLLKDKEELISSLEN
YIKLIKEQSNDFQLWKNDIYATLVDIETSHGEILNCANEEYSSYFKKRYIDNQETIRLLT
KLKNSIKKECSI
Download sequence
Identical sequences U2QMG1
WP_021753687.1.46596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]