SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U2SRQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U2SRQ0
Domain Number - Region: 33-105
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0942
Family Capz beta-1 subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U2SRQ0
Sequence length 105
Comment (tr|U2SRQ0|U2SRQ0_9FUSO) Uncharacterized protein {ECO:0000313|EMBL:ERL03499.1} KW=Complete proteome OX=1321774 OS=Leptotrichia sp. oral taxon 225 str. F0581. GN=HMPREF9108_02345 OC=Leptotrichia.
Sequence
MKTVTDEIIELMNDEDLLKRILNTLDKSKQHIEFYSNGYGVSIVPDINNATLYQVAVLVG
TEEEYDVCFDTPITDDVIEGLSILQAHEIAKQISELEPNFTGTLN
Download sequence
Identical sequences U2SRQ0
WP_021769716.1.46167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]