SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3INN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U3INN9
Domain Number - Region: 6-41
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00301
Family RILP dimerisation region 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3INN9
Sequence length 92
Comment (tr|U3INN9|U3INN9_ANAPL) Uncharacterized protein {ECO:0000313|Ensembl:ENSAPLP00000008862} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN= OC=Anatinae; Anas.
Sequence
VPQVTDKLQEMLTTSCSLKTTIEAFQEELQLLKDNFQKAGLEELRERVAQQDKHSNLLQN
ILDQMAEVRRELGTFPWQASVLCSLCRVSTGE
Download sequence
Identical sequences U3INN9
ENSAPLP00000008862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]