SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U4KLC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U4KLC8
Domain Number - Region: 48-101
Classification Level Classification E-value
Superfamily RNA-binding protein She2p 0.0085
Family RNA-binding protein She2p 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U4KLC8
Sequence length 168
Comment (tr|U4KLC8|U4KLC8_ACHPJ) Uncharacterized protein {ECO:0000313|EMBL:CCV64617.1} KW=Complete proteome; Reference proteome OX=1318466 OS=Acholeplasma palmae (strain ATCC 49389 / J233). GN=BN85410400 OC=Acholeplasmataceae; Acholeplasma.
Sequence
MISNIKEALVANNKIDLDINLQAINVKKETLLQKLMDRKAQVYMYYLDDEYIGNLITEEK
LHEIIIVNCYAVKIGDEYDILHHFLNENKHKTVLLATMNLKQSSNDLLENFKREIAVFKT
GMYDLGISIIVEGIKFNILSNKIIKQEEVKTYLEETRIIEDLISVSTR
Download sequence
Identical sequences U4KLC8
WP_026661013.1.14279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]