SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U4L7Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U4L7Y8
Domain Number 1 Region: 139-254
Classification Level Classification E-value
Superfamily NosL/MerB-like 5.75e-42
Family MerB-like 0.00004
Further Details:      
 
Domain Number 2 Region: 80-138
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-17
Family MerB N-terminal domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U4L7Y8
Sequence length 271
Comment (tr|U4L7Y8|U4L7Y8_PYROM) Similar to Alkylmercury lyase acc. no. P16172 {ECO:0000313|EMBL:CCX13273.1} KW=Complete proteome; Reference proteome OX=1076935 OS=Pyronema omphalodes (strain CBS 100304) (Pyronema confluens). GN=PCON_12866 OC=Pezizales; Pyronemataceae; Pyronema.
Sequence
MTDLVVIFEKKPVEMSILKIYKSYDNTLERFWIPRKTYSIKYIFLRILQSNEEKVMKTEI
QELVTLFDQNKGEGGGSMKWLFRPLLQMLTKGEPVTVEDIATTTGKPLDEVKDILSTLSS
VELDEQGRVVGFGLTLIPTPHRFEVDEKQLYAWCALDTLMFPELIGHMVHIESPCYSTGK
PIRLTVEPDRVLSLEPTTAVVSIVTPDDTSSVRSSFCNEVHFFSTESAAQNWLNQHPNGK
VYPVKEAFELGRLLGKRYEESGPTNESCCDI
Download sequence
Identical sequences U4L7Y8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]