SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U4LQP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U4LQP5
Domain Number 1 Region: 2-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.97e-84
Family Capz alpha-1 subunit 0.00000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U4LQP5
Sequence length 278
Comment (tr|U4LQP5|U4LQP5_PYROM) Similar to F-actin-capping protein subunit alpha acc. no. Q9P5K9 {ECO:0000313|EMBL:CCX31660.1} KW=Complete proteome; Reference proteome OX=1076935 OS=Pyronema omphalodes (strain CBS 100304) (Pyronema confluens). GN=PCON_11183 OC=Pezizales; Pyronemataceae; Pyronema.
Sequence
MSTDAIETVSGFILDAPPGELKDVLSDVKALIGDDDEIVQELIPAVAQYNKEQLVVVKLP
GSSVLVPVSDANELEDGRFCDVESSSSFAFDHLNQKASNVQSWTLESQNADLIKSLVKAT
STHVSEHYPSNPAFTVAPIENDSKVAINLTGAKFSPANYWNGRWRSMYIFDPSSNMLTGD
IKVDVHYYEDGNVRLLSKNTLEIEIPGGSASEIIKAISKKEKDYQASLNEEFETMNQGAF
KALRRQLPVTRQKIDWQKIGSYRLGQKVGLFPTHQAQE
Download sequence
Identical sequences U4LQP5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]