SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U4UL99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U4UL99
Domain Number 1 Region: 73-173
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00000636
Family Biotinyl/lipoyl-carrier proteins and domains 0.01
Further Details:      
 
Weak hits

Sequence:  U4UL99
Domain Number - Region: 19-58
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0199
Family Capz alpha-1 subunit 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U4UL99
Sequence length 211
Comment (tr|U4UL99|U4UL99_DENPD) Uncharacterized protein {ECO:0000313|EMBL:ERL93877.1} KW=Complete proteome; Reference proteome OX=77166 OS=Dendroctonus ponderosae (Mountain pine beetle). GN=D910_11163 OC=Cucujiformia; Curculionidae; Scolytinae; Dendroctonus.
Sequence
MNSDLPKNIAESIEALSVPILESISKEEIEGFKPYYERYYENKYCTIFNTDTENNDILLR
FHTNRLILVSIAAGHDIFRHKKTIESIDFNVNGTNMLDISISGKKKAGAKKLKKNSVLCF
IKCKDDDKQYPVCSCIPASLIEVNHLVLDKPQLLISSYKEFGFIGVLYPQRSGPKASSID
KMFADLKLHSESEYQQYLGSRREATEAEIVP
Download sequence
Identical sequences U4UL99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]