SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U5DA62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U5DA62
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily Vanabin-like 0.00876
Family Vanabin-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U5DA62
Sequence length 82
Comment (tr|U5DA62|U5DA62_AMBTC) Uncharacterized protein {ECO:0000313|EMBL:ERN18317.1} KW=Complete proteome; Reference proteome OX=13333 OS=Amborella trichopoda. GN=AMTR_s00055p00185330 OC=Amborellaceae; Amborella.
Sequence
MIVSHCVARNEDNGGSNCKGCITNHFDHRCPLCRPVLRCVAGCLWNGISKSKCVKTCNSR
KRKPRLEDCKRCMASCKCSCVT
Download sequence
Identical sequences U5DA62
ERN18317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]