SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U5F5Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U5F5Y9
Domain Number - Region: 8-23
Classification Level Classification E-value
Superfamily Amb V allergen 0.0301
Family Amb V allergen 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U5F5Y9
Sequence length 53
Comment (tr|U5F5Y9|U5F5Y9_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EFE45901.1} KW=Complete proteome OX=552396 OS=Erysipelotrichaceae bacterium 5_2_54FAA. GN=HMPREF0863_02275 OC=Erysipelotrichaceae.
Sequence
MARKKYRPGMNCEKTGKYACYDANGNEMYRDIDVEKDRRFPPSQEEGCYYEEQ
Download sequence
Identical sequences A0A1C6CQ89 H1BIL2 U5F5Y9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]