SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5H793 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5H793
Domain Number 1 Region: 4-277
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.84e-79
Family Capz beta-1 subunit 0.000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U5H793
Sequence length 287
Comment (tr|U5H793|U5H793_USTV1) Uncharacterized protein {ECO:0000313|EMBL:KDE06477.1, ECO:0000313|EnsemblFungi:MVLG_03131T0} KW=Complete proteome; Reference proteome OX=683840 OS=(Anther smut fungus). GN=MVLG_03131 OC=Microbotryomycetes; Microbotryales; Microbotryaceae; Microbotryum.
Sequence
MSNEDTLSACLDLARRLPPHRIEHNLGLLCDILPDLADDILSSVDQPLKVHVDKESKQYL
VCDYNRDGESYRSPWTNAYDPPLADGTTPSPKLRQLEITMNDSFDVYRDLYYEGGVSSVY
LWDVDGGFAGVVLLQKSNGMSSSSASASSWDSVHVFEASERGRTAHYKLTSTVMLYISRT
AKEAPEQSEFTLCGSMTRQNELEAPLDPASNQLGSHIVNLGRMIEDMEIKMRNLLQEVYF
SKTKDIVSSLRSTVGYGEQNKRMALQGELVGLLRGKNAAQAGSGLSV
Download sequence
Identical sequences U5H793
MVLG_03131T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]