SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5H7X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5H7X2
Domain Number 1 Region: 1-145,245-378
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.46e-58
Family Capz alpha-1 subunit 0.0000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U5H7X2
Sequence length 386
Comment (tr|U5H7X2|U5H7X2_USTV1) Uncharacterized protein {ECO:0000313|EMBL:KDE06302.1, ECO:0000313|EnsemblFungi:MVLG_03342T0} KW=Complete proteome; Reference proteome OX=683840 OS=(Anther smut fungus). GN=MVLG_03342 OC=Microbotryomycetes; Microbotryales; Microbotryaceae; Microbotryum.
Sequence
MASLQDRLQAASEFLLQSPPGEVNDVFSDVRLLVSDDNALEASIVPTLSLYNRTNYVAIT
LENDPSTSFLLTEGGRIVSPSKDQEEERYVCPSSQTSYKVNHLRLTASDPRPFPIEHETQ
AIRDKVADLLAKFVKNHYHDAKSEVVVLEDGNFPAPLNEEEIEEPKLATVDDTKIDEEAK
VDEEEGSETIEGKEATEGEVESSTTASASREEDPAPVSPIQVDNEPTQAAALEEPTEQPT
EPKPKVLHPRTSRIFALYFVGNKYNPSNYWTGRWRSVYTIDMAKRSVEAKAEINVHYYEQ
GNVQLSTLLTSTLPLPTSNPSPESLIALLKSSETTFSSQLADAFESFSEEGFKGLRRALP
KNKCKMDWEKVGHYKLGREMGGTTEV
Download sequence
Identical sequences U5H7X2
MVLG_03342T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]