SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U5J9C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U5J9C5
Domain Number - Region: 120-144
Classification Level Classification E-value
Superfamily Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor 0.0706
Family Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U5J9C5
Sequence length 228
Comment (tr|U5J9C5|U5J9C5_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AGI11787.1} KW=Complete proteome; Reference proteome OX=1308863 OS=Bacillus phage vB_BanS-Tsamsa. GN= OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Siphoviridae.
Sequence
MKTLLKGWSAFEVIWITLFTALAVYMYFAFDDTAVGLTASLTGMWCVILVAKGKISNYFF
GAINTALYAYISYKSQLYGEFMLNAFLYFPIQFIGFYIWNKNKTLTGNDTVVKARKLSKK
GWAYVVATVAIVGVLYAGFLHMIGSQQAGVDGFAVVLSITAQLLMLKRFAEQWLLWICVN
VLTIILWFNVFMTDGNNITMLVMWIAYLCNSVYGYIKWSRNAKQSEVA
Download sequence
Identical sequences U5J9C5
YP_008873313.1.1618 gi|564292610|ref|YP_008873313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]