SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U5L493 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5L493
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily KaiA/RbsU domain 1.44e-27
Family Phosphoserine phosphatase RsbU, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 124-333
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000000379
Family PP2C-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U5L493
Sequence length 336
Comment (tr|U5L493|U5L493_9BACI) Phosphoserine phosphatase {ECO:0000313|EMBL:AGX02294.1} KW=Complete proteome; Reference proteome OX=1367477 OS=Bacillus infantis NRRL B-14911. GN=N288_01540 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MDFREMMESKYRDILENYLKDQSEQTLYQGQKFSRKSIEHKISPEEIISLHKSLLFEIYP
DLPENVLHSFDVLLEVMIGYGLAYREHQSLRHKQEELRSEMEIAANVQQTLLGTSVPAVD
SLDIGAISVPAKHMNGDYYHFVQDEHNNISIAIADVIGKGIPAALCMSMIKYAMDSLPEN
RHEPSSVLENLNRVVEQNVDPSMFITMFYGMYNTESHLFHYASAGHEPGFYYNAEKDEFS
ETTAKGLLLGVDKRTKYKQFEKEVHPGDMIVLMSDGVTECRTDEGFIEKDTLIGYIRKYI
HLSAQEIVTNIYKELEKLQHFQLRDDFTLIILKRNV
Download sequence
Identical sequences A0A231W605 U5L493
WP_022543254.1.5179 WP_022543254.1.91248 WP_022543254.1.9427 gi|549473393|ref|YP_008607035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]