SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5NGB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U5NGB0
Domain Number - Region: 82-152
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00471
Family Capz alpha-1 subunit 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U5NGB0
Sequence length 164
Comment (tr|U5NGB0|U5NGB0_9MOLU) Uncharacterized protein {ECO:0000313|EMBL:AGX89239.1} KW=Complete proteome; Reference proteome OX=1403316 OS=Mycoplasma parvum str. Indiana. GN=PRV_02515 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MSNQSLIVLLTSGTVIGGGITFWIPNSSEVNARTIYLYNENGIADVLKIGESNVKTFPIN
FESLLKVGKKRWEHQSERYNSNINSNTTWRIIGKDSKQSSHWKSMHKSAFTENNSNFRGS
IKFYLSGYECQTLKEKVLKNFNQEVPKQTEKEKNLFICESVKKK
Download sequence
Identical sequences U5NGB0
gi|550986851|ref|YP_008680132.1| WP_022770337.1.66008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]