SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5T9Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U5T9Y9
Domain Number - Region: 2-72
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0994
Family Capz alpha-1 subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U5T9Y9
Sequence length 76
Comment (tr|U5T9Y9|U5T9Y9_COWPX) CPXV134 protein {ECO:0000313|EMBL:AGY97645.1} KW=Complete proteome OX=10243 OS=Cowpox virus (CPV). GN=CPXV134 OC=Orthopoxvirus. OH=9606,9685,9785,9913,10090,10129,29092,447135
Sequence
MSWYEKYNIVLNPPKRCSSSCADNLTTILAEDGNNIRAILYSQPQKLKVLQDFLATSRNK
MFLYKILDDEIRRVLT
Download sequence
Identical sequences U5T9Y9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]